PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_13758
Common NameKK1_014180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 252aa    MW: 29525.9 Da    PI: 5.0253
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_13758genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.2e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT++Ede+l+ +v+++G  +W++ ++  g+ R++k+c++rw++yl
    C.cajan_13758 14 KGTWTPQEDEKLIAYVTRYGHWNWNLLPKFAGLERSGKSCRLRWLNYL 61
                     799*****************99************************97 PP

2Myb_DNA-binding56.94.8e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T+eEde ++++ ++lG++ W+tIa+ ++ gRt++++k++w++ 
    C.cajan_13758  67 RGNYTKEEDETIIQLLQRLGNR-WSTIAAQLP-GRTDNEIKNYWHTN 111
                      899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.728961IPR017930Myb domain
SuperFamilySSF466895.08E-3011108IPR009057Homeodomain-like
SMARTSM007173.6E-121363IPR001005SANT/Myb domain
PfamPF002491.1E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-231568IPR009057Homeodomain-like
CDDcd001671.07E-91661No hitNo description
PROSITE profilePS5129424.51262116IPR017930Myb domain
SMARTSM007177.6E-1766114IPR001005SANT/Myb domain
PfamPF002494.1E-1667111IPR001005SANT/Myb domain
CDDcd001679.75E-1269112No hitNo description
Gene3DG3DSA:1.10.10.607.8E-2669115IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MVKNTFSDKT GLRKGTWTPQ EDEKLIAYVT RYGHWNWNLL PKFAGLERSG KSCRLRWLNY  60
LKPDIKRGNY TKEEDETIIQ LLQRLGNRWS TIAAQLPGRT DNEIKNYWHT NLKKRYQQSS  120
NICSKIQVSE SKDETPVVKP DQNNINNVQV PFQNFPPISR LTDSCMTSSS NEFSTTTQNF  180
DFVDAYQDSM SENFWLETYV FDTSCDPCDI FVGEPHCFSP VHDVQLWCHD NEFCDIEQKV  240
MNNVDDEETL YK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-27121152104MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-27121152104C-Myb DNA-Binding Domain
1msf_C1e-27121152104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539518.11e-110PREDICTED: myb-related protein Myb4-like
TrEMBLA0A151SVF00.0A0A151SVF0_CAJCA; Myb-related protein Myb4
STRINGGLYMA12G32530.21e-109(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06180.17e-54myb domain protein 13